SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for L0RUS6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  L0RUS6
Domain Number - Region: 124-199
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0314
Family Capz beta-1 subunit 0.047
Further Details:      
 
Domain Number - Region: 422-453
Classification Level Classification E-value
Superfamily HBS1-like domain 0.0458
Family HBS1-like domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) L0RUS6
Sequence length 564
Comment (tr|L0RUS6|L0RUS6_MYCC1) Uncharacterized protein {ECO:0000313|EMBL:CCP24328.1} KW=Complete proteome; Reference proteome OX=1246955 OS=Mycoplasma cynos (strain C142). GN=MCYN_0596 OC=Bacteria; Tenericutes; Mollicutes; Mycoplasmataceae; Mycoplasma.
Sequence
MKIKPIISLLSFGMILSVISCTNPIDIKNDKPKIQKDISDSELNNLNNITIYKINDLQND
LPKIMSIPLKKQNFNSYHIIDSNLEQINAIMDIIPDLYRKAFNIEIPNLNNTNYDKVQSI
LDKNRIKTYLLNAEPNQIKKIIKQLYEIVNEKITLIKELRVSFSDESHIRNSLICDNTNK
ENCGYYNIYKNKKFTQFDIKNENNTLTKFDQLDKIQTIENSYFMFLFLTKRNILLEFLNE
RSIIKDANSIANLSQNLKEIYSTLFDFVTLRPKIKIPNAKSKILSYQEFAKQNKSKLIKI
INDTFNKKTINLINTNTNSPLLWDIYNIKNVSDNHFYKEKADKFELLNNDISPLTFKYLS
EIRISDNKLKSLKLNIFGIHKSFDEQKFNEYKNLYQKSEKFINLIDLKRSLIKAKQLFSI
ILENRELVKQITKNDFDYNNFIDAIIKKDTKKQQLYLSLFDFRKWLLEHHIKAYEDKNDK
QPYNSENAAKLLEKLINELIINKEISDTTVFDTKLKEKNHKIYENKLLEFSKNSENIHIL
RFLNSFLDYINSIDTLLKYIPKEI
Download sequence
Identical sequences L0RUS6
gi|433624800|ref|YP_007258430.1| WP_015287452.1.95375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]