SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for L1IYJ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L1IYJ0
Domain Number 1 Region: 4-128
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.62e-45
Family Calponin-homology domain, CH-domain 0.0000188
Further Details:      
 
Domain Number 2 Region: 186-247
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 1.44e-17
Family EB1 dimerisation domain-like 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) L1IYJ0
Sequence length 253
Comment (tr|L1IYJ0|L1IYJ0_GUITH) Uncharacterized protein {ECO:0000313|EMBL:EKX41328.1, ECO:0000313|EnsemblProtists:EKX41328} KW=Complete proteome; Reference proteome OX=905079 OS=Guillardia theta CCMP2712. GN=GUITHDRAFT_159896 OC=Eukaryota; Cryptophyta; Pyrenomonadales; Geminigeraceae; Guillardia.
Sequence
MASIGMMDAAFFVGKNELLNWLNELLGLNYSKVEQCANGAAYCQIMDAIYPGEVPLKKVI
FDAKLEHDFVKNYKVLQTVFDKKNIAKHIEVNKLIKAKPLDNLEFLQWIKRYFDMHYGGQ
EYNPVERRGGLTMKENTGANPLASKPATKTVKSAPMRVVRDAPSSSRPTSANPASAAPKK
TADGEQVQQLNEELTSLKLTVAELEKERDFYFGKLRDIEITCQTNEKGEVKELVDDIQKI
LYSTSEEEVQPAA
Download sequence
Identical sequences L1IYJ0
jgi|Guith1|159896|estExt_fgenesh2_pm.C_600004 XP_005828308.1.50599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]