SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for L2G1L7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  L2G1L7
Domain Number - Region: 28-56
Classification Level Classification E-value
Superfamily Vanabin-like 0.0314
Family Vanabin-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) L2G1L7
Sequence length 84
Comment (tr|L2G1L7|L2G1L7_COLGN) Uncharacterized protein {ECO:0000313|EMBL:ELA32275.1} KW=Complete proteome; Reference proteome OX=1213859 OS=(Glomerella cingulata). GN=CGGC5_7651 OC=Colletotrichum.
Sequence
MRFTPAFVIAMASVASAGPIANEKRTGGNAPACMAFCWEFCIVPTACGTCIAACMAVANP
AKELDTSEFQAIVDAAKPGAVAAQ
Download sequence
Identical sequences L2G1L7
XP_007278686.1.4750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]