SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for L2GJA5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  L2GJA5
Domain Number - Region: 174-261
Classification Level Classification E-value
Superfamily Hypothetical protein MG354 0.0275
Family Hypothetical protein MG354 0.004
Further Details:      
 
Domain Number - Region: 240-340
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0418
Family Capz beta-1 subunit 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) L2GJA5
Sequence length 586
Comment (tr|L2GJA5|L2GJA5_VITCO) Uncharacterized protein {ECO:0000313|EMBL:ELA40946.1} KW=Complete proteome; Reference proteome OX=993615 OS=(Nosema corneum). GN=VICG_02035 OC=Eukaryota; Fungi; Microsporidia; Nosematidae; Vittaforma.
Sequence
MVVTKASENENNLDVGSMNDSTRSTFYSIQSGTPPIESTGVLSSIFARILSGKILNGNFV
VVWNDFGGYSRLEDVSKKIAGNLRLAISMVNEGRLRDARAELLSLVESSSVQGKLIIYNH
LAYIHFLFLEFHESIFYLDLFLEIACGYDWEFGFNCKLLLERHAGVPSLTPFVTVEFPLD
KVEPTIGNIGVDVISRNFENKLLVRQILSTSFQRISLYSKVYCTKEYLAQFFKTFRKLVP
GFAIIFIFHHNDKLYIYNVLKAVSLDHPRECSDGCYLSIYWKDVVDEFENVMAENQKVLS
MNAVTAEDKKYWWSTRIRLDQSLGELIRKLRSRINNNINDCKEGVSGIETEDGIKNKKDA
ANEETDGDNSSRLLLILEDSVAFFPFEAVFDKPAMRILTQDFSFHTSVSDIKSIFYLLDP
ANNLQNTRSTIFEYLDSKNFDKDFLKGVIGRSLDPEEMRLLYKNELFMYFGHGTGKKHFD
VPSITPKLLFLFGCSSCKLIHIQNFKSNGFCLRHLKKKRILLGNLWDVTDKDLDKLTLAF
LEDFFEGKDVLESIFVNRNVCKLKFLNSAALVVYGIVPRNFKIESK
Download sequence
Identical sequences L2GJA5
XP_007605480.1.86858

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]