SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for L2GJA8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L2GJA8
Domain Number 1 Region: 126-200
Classification Level Classification E-value
Superfamily RPB5-like RNA polymerase subunit 2.88e-24
Family RPB5 0.00047
Further Details:      
 
Domain Number 2 Region: 8-129
Classification Level Classification E-value
Superfamily Eukaryotic RPB5 N-terminal domain 7.45e-17
Family Eukaryotic RPB5 N-terminal domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) L2GJA8
Sequence length 206
Comment (tr|L2GJA8|L2GJA8_VITCO) Uncharacterized protein {ECO:0000313|EMBL:ELA40963.1} KW=Complete proteome; Reference proteome OX=993615 OS=(Nosema corneum). GN=VICG_01993 OC=Eukaryota; Fungi; Microsporidia; Nosematidae; Vittaforma.
Sequence
MRPSKRKLHMRELWLARNTIIEMLNERGYSSSNMPLDYASFVSQFPNAENNPSTLNFVCS
KDQPFAVHFTSEDKLSKKSLETLTNEYAAQGIANVILITSAKLNPACKVLMKSIKLNLEH
FLVEELQFNITKHHLVPKHRIMSESEQKELLNKLKCEMSNLPTILTTDPVCRFFGAKAGV
IFEITRNSQTAGTALYYRVVREPGPK
Download sequence
Identical sequences L2GJA8
XP_007605438.1.86858

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]