SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for L5M8B2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L5M8B2
Domain Number 1 Region: 2-118
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.09e-27
Family Capz beta-1 subunit 0.00000365
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) L5M8B2
Sequence length 122
Comment (tr|L5M8B2|L5M8B2_MYODS) F-actin-capping protein subunit beta {ECO:0000313|EMBL:ELK34567.1} KW=Complete proteome; Reference proteome OX=225400 OS=Myotis davidii (David's myotis). GN=MDA_GLEAN10025068 OC=Vespertilionidae; Myotis.
Sequence
MPSARLRKLEVAANNVFDQHRDLYFQDGISSAYLWDLAHGFAGVILIKRAGDGSENIKGC
WDSTHMAAVQEKSSGPIARRKLASTVMLWLQTSKSSSGTMNPGGSSIRQTEKDETASDCS
HT
Download sequence
Identical sequences L5M8B2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]