SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for L5MDC3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L5MDC3
Domain Number 1 Region: 122-391
Classification Level Classification E-value
Superfamily EndoU-like 2.35e-95
Family Eukaryotic EndoU ribonuclease 0.0000066
Further Details:      
 
Domain Number 2 Region: 74-113
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000000248
Family Somatomedin B domain 0.0016
Further Details:      
 
Domain Number 3 Region: 1-41
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000000327
Family Somatomedin B domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) L5MDC3
Sequence length 397
Comment (tr|L5MDC3|L5MDC3_MYODS) Poly(U)-specific endoribonuclease {ECO:0000313|EMBL:ELK36381.1} KW=Complete proteome; Reference proteome OX=225400 OS=Myotis davidii (David's myotis). GN=MDA_GLEAN10022512 OC=Vespertilionidae; Myotis.
Sequence
MESCASRCNEKFNRDAACQCDRQCPWYWDCCDDYQHLCTVEEDPREPEPFLELEEEMEEE
MEEAPASNLYSAPDSCRGRCHESFDRHHPCHCNARCPEFGNCCEDFESQCGHEGFSHSSD
AITTEELKAISEKIYRADTNKAQKEDIILNSQNAISPSETRDQVDHCPEPLFTYVNEKLF
SKPTYAAFINLLNNYQRATGQGEHFSAQQLAEQDTFLREVMKTAVMKELYSFLHHQNRYS
SEQEFVNDLKNMWFGLYSRGNEEGDSSGFEHVFSGEIKKGKVTGFHNWIRFYMQEKEGLV
DYYSHIYDGPWESYPDVLAMQFNWDGYYKEVGSAFIGSSPEFEFALYSLCFIARPGKTCQ
LSLGGYPLAIQTYTWDKSTYGNGKKYIATAYVVSSTR
Download sequence
Identical sequences L5MDC3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]