SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for L7HX49 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L7HX49
Domain Number 1 Region: 6-108
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.72e-32
Family Calponin-homology domain, CH-domain 0.0000531
Further Details:      
 
Domain Number 2 Region: 160-225
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 2.22e-16
Family EB1 dimerisation domain-like 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) L7HX49
Sequence length 238
Comment (tr|L7HX49|L7HX49_MAGOY) Microtubule integrity protein mal3 {ECO:0000313|EMBL:ELQ35583.1} KW=Complete proteome OX=1143189 OS=oryzae). GN=OOU_Y34scaffold00702g3 OC=Magnaporthe.
Sequence
MGESRLLQLNITKVEQCGTGAALCQVFDSIFLDVPMSRVKFNVNSEYAYIQNFKVLQNTF
TKHQVDKPIPVAGLVKCKMQDNLEFLQWVKRFWDQYYPGGEYDAVARRKGAPLGAAGGGG
GGAAVRAPVAGGAARRAGGTTPTTGAARAGLGVSKANPALAQENATLKETVVGLERERDF
YFSKLRDIELLVQNAVEEDPEIEKQEDGLVKQIQAILYSTEEGFEIPAEGEVDDQETF
Download sequence
Identical sequences L7HX49

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]