SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for L7HYY5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L7HYY5
Domain Number 1 Region: 456-721
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.09e-85
Family Capz alpha-1 subunit 0.00000368
Further Details:      
 
Domain Number 2 Region: 74-259
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.89e-65
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.00000043
Further Details:      
 
Domain Number 3 Region: 265-399
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 9.95e-36
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.0000593
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) L7HYY5
Sequence length 730
Comment (tr|L7HYY5|L7HYY5_MAGOY) 2-oxoisovalerate dehydrogenase subunit beta {ECO:0000313|EMBL:ELQ35906.1} KW=Complete proteome OX=1143189 OS=oryzae). GN=OOU_Y34scaffold00683g18 OC=Magnaporthe.
Sequence
MNAAAVTRPLRGFLANSRPAVPSISKSQRQRLYSTHPPNARLNVPIDYSTTPLLAHSSQT
ALSNPELSPEVRNGATKRMNLFQAINDALSTALAEDESVMLFGEDVAFGGVFRCSMGLAE
KHGGERVFNTPLCEQGIMGFAIGMAAEGMRPVAEIQFADYVFPAFDQMVNEAAKFRYRDG
ANGRSAGGLTVRMPCGLVGHGALYHSQSPESLFTHIPGFRVVMPRSPVQAKGLLLAAIRS
NDPVVFMEPKVLYRAAVEQVPMASYTLPLSKAEILKEGKDLTIISYGQPLYICQNAIATA
EKDLGISVELIDLRTIYPWDKECVFESVRKTGRAIVVHESMVNQGVGAEVAACIQEDADT
FNRLEAPVERVAGWSIPTPLAFEKFNAPDAARVYDRIKRGRCDFLVASRAVSYQDTFAFG
VAPHSVAYSDNADAPFFHNSYPRLAIAPVKTTPSPIMSDDHVSILSEFLEGAPPGELRSR
RIDIKSISSGDAKVVSKLAPAFERYNEEQFTTVKLPGGSQKVIVSAHNSLGDGRYYDVES
SSSFAFDHTTQKASAVQSYALESAHSDLVKSTLKSLGPYVSEHFPNAAYGVYPIESDSKL
AIIIVSNKYSPNNFWNGRWRSLYTLDPASGAIDGSIKVDVHYYEDGNVRLLTDKATTATV
PSATGSAIVKEIGSSEKKYQEELNRGFTDLSEGAFKGLRRQLPVTRQKIEWDKVASYRLG
QDIGGGRRQG
Download sequence
Identical sequences L7HYY5 L7JDG7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]