SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for L7I0E7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L7I0E7
Domain Number 1 Region: 4-285
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 9.16e-79
Family Capz beta-1 subunit 0.0000000876
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) L7I0E7
Sequence length 288
Comment (tr|L7I0E7|L7I0E7_MAGOY) F-actin-capping protein subunit beta {ECO:0000313|EMBL:ELQ36679.1} KW=Complete proteome OX=1143189 OS=oryzae). GN=OOU_Y34scaffold00648g26 OC=Magnaporthe.
Sequence
MAADPFDSALDLLRRLDPKHTTRHLNGLMTIVPDLTEDLLSSVDQPLTVRRCKQTGREYL
LCDYNRDGDSYRSPWSNEFDPPLDDGPGGLGGVGPQGGNEGAGELGVPGERVRKMEVKAN
EAFDVYRDLYYEGGVSSVYLWNLDDGFAGVVLLKKAAPQGGNNEGVWDSIHVFEASERGR
STTYRLTSTVILTLSAGGGDSALGDMNLSGNMTRQLEQDMRTAEGDESHIANLGRLVEDM
ELKMRNLLQEVYFGKAKDVVGDLRSLGSLSEGQRDRDAQREIIGSMQR
Download sequence
Identical sequences G4MR53 L7I0E7 L7J0P8 Q5EMV8
XP_003709997.1.18062 148305.Q5EMV8 MGG_09902T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]