SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for L7MF18 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L7MF18
Domain Number 1 Region: 42-308
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.62e-96
Family Capz beta-1 subunit 0.00000000192
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) L7MF18
Sequence length 314
Comment (tr|L7MF18|L7MF18_9ACAR) Putative f-actin capping protein beta subunit {ECO:0000313|EMBL:JAA62555.1} OX=72859 OS=Rhipicephalus pulchellus. GN= OC=Rhipicephalus; Rhipicephalus.
Sequence
KTLGRSEQAIIRVCYGVTTSVRFQRALANYFLLVKFTMTTADQQLDSALDLMRRLPPQKI
EKNLSDLIDLVPGLCEELLSSVDQPLKIATDKKCGKDYLLCDYNRDGDSYRSPWSNNYEP
PLEDGALPSERLRKLEVDANNAFDQYREMYFEGGVSSVYLWDLDHGFAGVVLIKKGGDGS
KKIMGSWDSIHVVEVQEKSSGRNAHYKLTSTAMLWLQTKKPGSGTMNLGGSLTRQMEQDS
PVSEAVPHIANIGKMVEDMENKIRTTLNEIYFGKTKDIVNGLRSLQPLQDRKQQEALRND
LAQALRNRQAKQDS
Download sequence
Identical sequences L7MF18

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]