SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for L7VKG1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  L7VKG1
Domain Number - Region: 384-468
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0445
Family Capz beta-1 subunit 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) L7VKG1
Sequence length 555
Comment (tr|L7VKG1|L7VKG1_CLOSH) Peptidase M56 BlaR1 {ECO:0000313|EMBL:AGC67232.1} KW=Complete proteome; Reference proteome OX=1121335 OS=8532 / NCIMB 11754). GN=Cst_c02080 OC=Ruminiclostridium.
Sequence
MKDFMIMLITYSAALSPVILSYAALTSLLSKRYSAKGLYYSWLVIVIGLIVPYRPQICAG
IINSSNNNKIIPENNIFPGFSAVSISHLNNKVFPRFPLQGKWWTFIFAVWLCGIMFFLSY
QCFKHLRLVKAFNRWSKEIKNEKTASILKKVMRDLALSGKIKLLSCPYAGSPVLIGLFNP
RIIIPEQDYTDDELYFILRHELVHYKRRDLWYKSLILLATAIHWFNPAVYIMAKIVGMQC
ELSCDEYVVSGMDAATRYRYCETLIGIFKKQTLMSTALTTNFYGGKNGMKRRILSIMNEG
KRKIGLFIAGILLAVVIGAGFYCKAVNPADTLTPSSGKFNAAVSIKMAGMENTRENTGTS
VRYVDPRPSLEFYIEGENIAKIDISCENEYLAAIDWTKTQHRKYWDVNYYQTFDEETQAS
VFYPDKYFDKTISLSFNEDFTDYQNIWYRWHALNLYEWALENNYSRFFGYGSGQKIKMPD
NPTEDQKLMLAAGNDGSGLTGLGHIQLSGYPDELTKDRITVKITDRTGNTITKLINVKIS
NNEFNETVVTAYLEN
Download sequence
Identical sequences A0A1B1YAD6 L7VKG1
WP_015357929.1.17222 WP_015357929.1.59275 WP_015357929.1.85589 gi|472465642|ref|YP_007678321.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]