SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for L7ZVB4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L7ZVB4
Domain Number 1 Region: 154-274
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.83e-18
Family Histidine kinase 0.023
Further Details:      
 
Weak hits

Sequence:  L7ZVB4
Domain Number - Region: 13-62
Classification Level Classification E-value
Superfamily PG0775 C-terminal domain-like 0.0418
Family PG0775 C-terminal domain-like 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) L7ZVB4
Sequence length 282
Comment (tr|L7ZVB4|L7ZVB4_9BACI) Two-component sensor histidine kinase {ECO:0000313|EMBL:AGE21019.1} KW=Complete proteome OX=1233873 OS=Geobacillus sp. GHH01. GN=GHH_c04540 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Geobacillus.
Sequence
MLDSFFRKQWQAVVQALRHIEQGEMGELHREGPPPELQDVWQQIAKLQTQWLEQTKRVQK
LAAEKAEQEERLVERILSEERTRLARELHDSVSQQLFAASMMMSAVMETMPSDDERHRKQ
LKMVEQMIHQSQLEMRALLLHLRPVQLKGKSLQEGMNELLTELAGKVPLEMKWKIEDIPL
DKGVEDHLFRILQESLSNTLRHAKAKSLEVLLIERDGFAILRVTDDGVGFDVERSKSGSY
GLQHMYERAAEIGGMLKIVSLKGQGTRLEVKVPLLHRGDDRD
Download sequence
Identical sequences L7ZVB4
gi|448236712|ref|YP_007400770.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]