SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for L8F1F9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  L8F1F9
Domain Number - Region: 14-69
Classification Level Classification E-value
Superfamily Hypothetical protein YojF 0.0379
Family Hypothetical protein YojF 0.013
Further Details:      
 
Domain Number - Region: 62-150
Classification Level Classification E-value
Superfamily NTF2-like 0.0789
Family Ketosteroid isomerase-like 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) L8F1F9
Sequence length 152
Comment (tr|L8F1F9|L8F1F9_MYCSE) UPF0311 protein D806_6910 {ECO:0000256|HAMAP-Rule:MF_00775} KW=Complete proteome OX=1214915 OS=Mycobacterium smegmatis (strain MKD8). GN=D806_6910 OC=Mycobacterium.
Sequence
MKLEPEFSYTAELAEPQIVGPGPYGLRQVLAVTGGKVTGNRFSGTAAPGGGDWLLAGEDG
YGRLDVRAQFYTDDGAVIYMSYQGLVEVNEAAAGALGGAGTGTDFGDHYFVTTPRLESGD
PRYAWVNQTIFVGQGRIQPGPVVEFQVFRVAL
Download sequence
Identical sequences L8F1F9
WP_003898247.1.94974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]