SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for L8HJ59 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L8HJ59
Domain Number 1 Region: 3-270
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.88e-86
Family Capz beta-1 subunit 0.0000000356
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) L8HJ59
Sequence length 277
Comment (tr|L8HJ59|L8HJ59_ACACA) Factin-capping protein subunit beta, putative {ECO:0000313|EMBL:ELR24441.1} KW=Complete proteome; Reference proteome OX=1257118 OS=Acanthamoeba castellanii str. Neff. GN=ACA1_333210 OC=Acanthamoebidae; Acanthamoeba.
Sequence
MGSELDCALDLMRRMPPSSIEDNLAGLIDLVPDLTEQLLSMVDQPLKVAHDSQARRDYLL
CDYNRDGDSYRSPWTNKYDPSLPDGALPSAQLRQLEVQANEVFDIYRDLYFEGGVSSVYC
WDLDDGFAAVVLIKKTQDQSKKGQPMKGTWDSIHVVEVVDKGKNAHYKLTSTVMLFIETE
TKETGRVTLAGSLTRQARHFLHDEKDFPVDKVNPHVANIGRMIEDMELKLRTTLQTIYFG
KTKDIVNELRQVMPVSVLKSRSALQQQIAGAIGGRGN
Download sequence
Identical sequences L8HJ59
XP_004355015.1.79595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]