SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for L8J1U4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L8J1U4
Domain Number 1 Region: 8-281
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 5.23e-117
Family Capz alpha-1 subunit 0.000000000258
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) L8J1U4
Sequence length 286
Comment (tr|L8J1U4|L8J1U4_9CETA) F-actin-capping protein subunit alpha-1 {ECO:0000313|EMBL:ELR62686.1} OX=72004 OS=Bos mutus (wild yak). GN=M91_03146 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MADFEDRVSDEEKVRIAAKFITHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNMD
QFTPVKIEGYEDQVLITEHGDLGNSRFLDPRNKISFKFDHLRKEASDPQPEEADGGLKSW
RESCDSALRAYVKDHYSNGFCTVYAKTIDGQQTIIACIESHQFQPKNFWNGRWRSEWKFT
ITPPTAQVVGVLKIQVHYYEDGNVQLVSHKDVQDSVTVSNEAQTAKEFIKIIEHAENEYQ
TAISENYQTMSDTTFKALRRQLPVTRTKVDWNKILSYKIGKEMQNA
Download sequence
Identical sequences A4FUA8 L8J1U4
ENSBTAP00000042551 ENSBTAP00000042551 NP_001076949.1.59421 NP_001076949.1.76553 XP_005887151.1.15283 XP_010829115.1.44457 XP_019812386.1.53367 9913.ENSBTAP00000042551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]