SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for L8WPW9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L8WPW9
Domain Number 1 Region: 5-258
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.44e-69
Family Capz beta-1 subunit 0.00000015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) L8WPW9
Sequence length 261
Comment (tr|L8WPW9|L8WPW9_THACA) F-actin capping protein beta subunit {ECO:0000313|EMBL:ELU40055.1} KW=Complete proteome; Reference proteome OX=983506 OS=(Rhizoctonia solani). GN=AG1IA_05920 OC=Agaricomycetes; Cantharellales; Ceratobasidiaceae; Rhizoctonia.
Sequence
MTSIQVEENVALLCEMCPDYADDLLGSVDQPLQVRHDKVTGKEYLICDYNRDGDSYRSPW
SNEYDPPLEEGTQPSVKLRKLEVAANEGGVSSVFLWDLDDGGFAGVVLLKKSELMISVRY
RTLIGLCSIALPAPSPNEPSGSWDSIHVFEANERGRTAHYKLTSTVMLQLKVKSEASGEV
DLSGSMTRQQEEDRPLPDPAAHIANTGRMVEEMELKMRNLLQEVYFGKTRDVVFDLRSVE
SLDKQRKQRELQKELVGLLKR
Download sequence
Identical sequences L8WPW9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]