SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for L8YB49 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L8YB49
Domain Number 1 Region: 23-109
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.28e-39
Family Capz alpha-1 subunit 0.0000106
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) L8YB49
Sequence length 114
Comment (tr|L8YB49|L8YB49_TUPCH) F-actin-capping protein subunit alpha-2 {ECO:0000313|EMBL:ELV13643.1} KW=Complete proteome; Reference proteome OX=246437 OS=Tupaia chinensis (Chinese tree shrew). GN=TREES_T100021970 OC=Mammalia; Eutheria; Euarchontoglires; Scandentia; Tupaiidae; Tupaia.
Sequence
MSAFAQYNLDQFTPVKIEGYEDQVHYYEDGNVQLVSHKDIQDSLTVSNEVQTAKEFIKIV
EAAENEYQTAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA
Download sequence
Identical sequences L8YB49

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]