SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for L9KD52 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L9KD52
Domain Number 1 Region: 8-274
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.4e-81
Family Capz alpha-1 subunit 0.00000392
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) L9KD52
Sequence length 299
Comment (tr|L9KD52|L9KD52_TUPCH) F-actin-capping protein subunit alpha-3 {ECO:0000313|EMBL:ELW60578.1} KW=Complete proteome; Reference proteome OX=246437 OS=Tupaia chinensis (Chinese tree shrew). GN=TREES_T100004351 OC=Mammalia; Eutheria; Euarchontoglires; Scandentia; Tupaiidae; Tupaia.
Sequence
MALSVLNRKEKEKVIRRLLIQAPPGEFVNAFDDLCLLIRDEKLMHHQGECAGHQHCQKYS
VPLCIDGNPVLLSHHNVMGNYRFFDYQTKLSFKFDLLQNQLKDIQSHGIIRNEAEYLRTV
VLCALKLYVNDHYPMGNCNVLRKTIKHKEFLIACIEDHNYGSGGCWNGLWKSKWIFQVNP
FLTQVTGRIFVQAHFFRCVNLHIEISKDLKESLEIVNQAQLALNFARLVEEQENKFQAAV
LEELQELSNEALRKILRRDLPVTRTLIDWQRILSDLNLVMYPKLGYVIYSRSVLCNWII
Download sequence
Identical sequences L9KD52
XP_006155156.1.99106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]