SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M0AI97 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  M0AI97
Domain Number - Region: 139-183
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 0.000152
Family MJ1460-like 0.052
Further Details:      
 
Domain Number - Region: 15-123
Classification Level Classification E-value
Superfamily Hypothetical protein TM0875 0.0288
Family Hypothetical protein TM0875 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M0AI97
Sequence length 184
Comment (tr|M0AI97|M0AI97_NATA1) Uncharacterized protein {ECO:0000313|EMBL:ELY98420.1} KW=Complete proteome; Reference proteome OX=29540 OS=P-10747 / NBRC 102637 / 172P1). GN=C481_17362 OC=Natrialba.
Sequence
MHDRIGYEGSLEDAEVIGRSPQSYIAAGESVSTFVGKQVTTKLAQHGLEDIEGEEWYSLK
IPLAALYDMRDEYGDVRMRNMGRNVPEHVEFPPELSKVENALPGINQAYTQNHRGSEIGS
YEFEQAGSNEGVMICENPYPCEFDKGLIKGVAKKFADSHVTVEEVGDQCRSEGGQHCEYR
VEWI
Download sequence
Identical sequences M0AI97
WP_006110578.1.25937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]