SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M1BF23 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M1BF23
Domain Number 1 Region: 112-292
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 7.85e-48
Family Capz beta-1 subunit 0.00000501
Further Details:      
 
Domain Number 2 Region: 2-77
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.4e-19
Family Capz beta-1 subunit 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M1BF23
Sequence length 301
Comment (tr|M1BF23|M1BF23_SOLTU) Uncharacterized protein {ECO:0000313|EnsemblPlants:PGSC0003DMT400043683} KW=Complete proteome; Reference proteome OX=4113 OS=Solanum tuberosum (Potato). GN= OC=Solaneae; Solanum.
Sequence
MEAAMGLMRRIPPKHTETALSALLSLLPEHSSDLLSQVDQPLQVLCDMESGKEFILCEYN
RDADSYRSPIPGNFLPDVHIMEHLNMQCTSDDPLSPSSQSLWDSIQQNTTPRSPWSNKYH
PPLEDAPQPSLELRKLEVEANEVFAVYRDQYYEGGISSVYMWEDENEGFVACFLIKKDGS
KTGHGRRGYLQEGAWDAIHVIEVGPEEEEIVQYCLTSTVMLTLTTDNESSGSFNLSGSIR
RQMSMKLSVSEGHLCNMGKMIEEMEGKLRNSLDQVYFGKTNEMVCTLRPPAELVQMKLPD
A
Download sequence
Identical sequences M1BF23
PGSC0003DMP400029637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]