SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M1CAT8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M1CAT8
Domain Number 1 Region: 16-186
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.4e-41
Family Capz alpha-1 subunit 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M1CAT8
Sequence length 193
Comment (tr|M1CAT8|M1CAT8_SOLTU) Uncharacterized protein {ECO:0000313|EnsemblPlants:PGSC0003DMT400063559} KW=Complete proteome; Reference proteome OX=4113 OS=Solanum tuberosum (Potato). GN=102578400 OC=Solaneae; Solanum.
Sequence
MLEEDEDFLESETQLTDDQKIEIAKWFLLNAPAGEIQYVAKDVRAILKDENIYKKAAEES
FPSYNKSHLICLEFPNRSGDVLITSFSEVDKDEYLDPRTAQVARVDHVKQVCKDVRPARD
EELPSAFVEEYRSAMDAEIMKYVSETYPKGICSVYCTKGKDVEEPGFDFELVVVISAARH
SPQNFWCVRLLKL
Download sequence
Identical sequences M1CAT8
PGSC0003DMP400042795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]