SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M1CWW8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  M1CWW8
Domain Number - Region: 24-54
Classification Level Classification E-value
Superfamily Vanabin-like 0.0222
Family Vanabin-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M1CWW8
Sequence length 85
Comment (tr|M1CWW8|M1CWW8_SOLTU) Uncharacterized protein {ECO:0000313|EnsemblPlants:PGSC0003DMT400076514} KW=Complete proteome; Reference proteome OX=4113 OS=Solanum tuberosum (Potato). GN= OC=Solaneae; Solanum.
Sequence
MAMVLMILLSANMGIVGVAAQGVNCYDNCNTGCAGLPSKEYLKCDKKCHKRCGDDSYALN
FDNGGGDGRDDDGLLRNFSSRCHIV
Download sequence
Identical sequences M1CWW8
PGSC0003DMP400051834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]