SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M1EFW2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M1EFW2
Domain Number 1 Region: 42-315
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.06e-114
Family Capz alpha-1 subunit 0.000000000436
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M1EFW2
Sequence length 320
Comment (tr|M1EFW2|M1EFW2_MUSPF) Capping protein muscle Z-line, alpha 2 {ECO:0000313|EMBL:AER95449.1} OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN= OC=Mustelinae; Mustela.
Sequence
PSLGGGARRGGPHGKGEVRWPLPPPPPRFVARRKMADLDEQLSDEEKVRIAAKFIIHAPP
GEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNLDQFTPVKIEGYEDQVLITEHGDLGNGK
FLDPKNRICFKFDHLRKEATDPRPYEAENAVESWRTSVETALRAYVKEHYPNGVCTVYGK
KIDGQQTIIACIESHQFQAKNFWNGRWRSEWKFTITPSTTQVVGILKIQVHYYEDGNVQL
VSHKDIQDSLTVSNEVQTAKEFIKIVEAAENEYQTAISENYQTMSDTTFKALRRQLPVTR
TKIDWNKILSYKIGKEMQNA
Download sequence
Identical sequences M1EFW2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]