SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M1KKG0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M1KKG0
Domain Number 1 Region: 70-208
Classification Level Classification E-value
Superfamily E2F-DP heterodimerization region 4.71e-29
Family DP dimerization segment 0.0014
Further Details:      
 
Domain Number 2 Region: 16-76
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000907
Family Cell cycle transcription factor e2f-dp 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M1KKG0
Sequence length 212
Comment (tr|M1KKG0|M1KKG0_ENCCN) Transcription factor of the e2f/dp family {ECO:0000313|EMBL:AGE95741.1} OX=6035 OS=Encephalitozoon cuniculi (Microsporidian parasite). GN=ECU06_0260 OC=Eukaryota; Fungi; Microsporidia; Unikaryonidae; Encephalitozoon.
Sequence
MRHLNSEMDGSENKREGLKYITQAVFQVLRENGACTYSFICKNIVFPNTETLNRRIYDVL
NVMKAVRLVDKKGKRYFLVDDSNDVSKRREEAKKLMEMKKVFKFIVNRNSSAEDTHLERL
YLPFMVISTSKKADIHCETNEERSFFVFKSNKPLKVNEDLDILREIYENAHAGEKAADFS
IVDRLGGEKFECFGENNNLRGELDSDPFFFSF
Download sequence
Identical sequences M1KKG0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]