SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M1PCZ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  M1PCZ3
Domain Number - Region: 10-85
Classification Level Classification E-value
Superfamily MukF C-terminal domain-like 0.000994
Family MukF C-terminal domain-like 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M1PCZ3
Sequence length 87
Comment (tr|M1PCZ3|M1PCZ3_DESSD) Uncharacterized protein {ECO:0000313|EMBL:AGF77625.1} KW=Complete proteome; Reference proteome OX=1167006 OS=Desulfocapsa sulfexigens (strain DSM 10523 / SB164P1). GN=UWK_01053 OC=Desulfobulbaceae; Desulfocapsa.
Sequence
MTDETSKLDAIKASIEELRDEIRLEAHLGKAEAVQELEKLDKKWKAFLEQCKPVVDEAGK
TAENAGAALSLVADELKSGYERIRKLF
Download sequence
Identical sequences M1PCZ3
WP_015403321.1.24328 gi|451946683|ref|YP_007467278.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]