SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M1W533 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M1W533
Domain Number 1 Region: 3-233
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 5.75e-70
Family Capz alpha-1 subunit 0.0000249
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M1W533
Sequence length 242
Comment (tr|M1W533|M1W533_CLAP2) Probable actin-capping protein alpha-2 chain {ECO:0000313|EMBL:CCE29660.1} KW=Complete proteome; Reference proteome OX=1111077 OS=Claviceps purpurea (strain 20.1) (Ergot fungus) (Sphacelia segetum). GN=CPUR_03507 OC=Claviceps.
Sequence
MSTIETVSRFVEGAPPGELADVVADIKALTGFSSDVVSKLRPAFEKYNEEQLATVKLPGG
SQPKASAVQSHVLEGAQADLVKSTLKSLGAYVKEHFANAALGVYPIESDSKIAVAIVANK
YSPNNFWNGRWRSLYVFDPVSGSLEGSIKVDVHYYEDGNVRLLTNKPVTVSIPSGTGAGI
AKEISASEKKYQEELNKSFVNLSEGAFKGLRRQLPVTRQKIEWDKVTSYRLGQDIGGGSS
KR
Download sequence
Identical sequences M1W533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]