SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M2S0E5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M2S0E5
Domain Number 1 Region: 2-119
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 8.89e-31
Family Capz alpha-1 subunit 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M2S0E5
Sequence length 120
Comment (tr|M2S0E5|M2S0E5_ENTHI) F-actin-capping protein subunit alpha, putative {ECO:0000313|EMBL:EMD44257.1} KW=Complete proteome OX=885311 OS=Entamoeba histolytica KU27. GN=EHI5A_169220 OC=Eukaryota; Amoebozoa; Archamoebae; Entamoebidae; Entamoeba.
Sequence
MASESEKTKIVTTFLKDSPPGEFNNVLKDCREVVGDDSIFQECLPICLHDYNTEQLTVVM
DGTNPVIISKYTEQSAQEFIDPVNKKVVTFDHLSKQITSSQPLSSGLPGNDSLRQALQKN
Download sequence
Identical sequences M2S0E5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]