SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M2S345 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  M2S345
Domain Number - Region: 69-187
Classification Level Classification E-value
Superfamily IpaD-like 0.0162
Family IpaD-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M2S345
Sequence length 281
Comment (tr|M2S345|M2S345_ENTHI) Uncharacterized protein {ECO:0000313|EMBL:EMD45721.1} KW=Complete proteome OX=885311 OS=Entamoeba histolytica KU27. GN=EHI5A_244160 OC=Eukaryota; Amoebozoa; Archamoebae; Entamoebidae; Entamoeba.
Sequence
MINAQFTTQETVQEPAQPVVQSRHTHMASVKKLGRVDASILRKEERTLHKVHKYHLKINA
KLDKTIAVINRARNVIRKKGEGLANRLAKYGTRKLGHLMEYYNMADDDLKQQIKPIIDGM
VNTIRQKEQTIRSGIKKLVTNFYGVLDRTLKQLAYAKQVGDANNNAAKLGIHAIGDNISN
GLKTTQNTLKINTHNLRKVKRISKGAEKQIAHEYHKAERKEIAILKTARALLKQMRRKGK
HVFSKLRHQAKAEYRALYRQCTKKIIKVLLNQNSGIEDYEY
Download sequence
Identical sequences M2S345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]