SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M2SXC2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M2SXC2
Domain Number 1 Region: 2-262
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.22e-84
Family Capz beta-1 subunit 0.0000000953
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M2SXC2
Sequence length 265
Comment (tr|M2SXC2|M2SXC2_COCSN) Uncharacterized protein {ECO:0000313|EMBL:EMD66960.1} KW=Complete proteome; Reference proteome OX=665912 OS=and spot blotch fungus) (Bipolaris sorokiniana). GN=COCSADRAFT_33879 OC=Pleosporaceae; Bipolaris.
Sequence
MADPIDSALDLLRRLDPKDVKRNVDHIIQLNPSLEEDLLESVDIPLTVKKCSKTKRDFLC
CDYNRDGDSWRSPWSNEFEPPIDEGVTPSDRVRKMEVKANEAFDVYRELYFEGGISSVYL
WDMDDGFAGCVLLKKSVSPTPKSSGSWDSIHVFDAQDRARTSHYKLTSTVILSLGTDSEA
LGGLDLSGNMVRQVEADMAVEDDTSHVANIGKMVEDMELKMRNLLQEVYFGKAKDVVGDL
RSLQSLSQANKDRATQREMINSMGR
Download sequence
Identical sequences M2SXC2 M2V342 N4X3Q4
XP_007696487.1.66866 XP_014075120.1.79200 jgi|CocheC5_1|82306|estExt_Genewise1.C_30989

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]