SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M2T5I8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M2T5I8
Domain Number 1 Region: 6-262
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.26e-79
Family Capz alpha-1 subunit 0.00000624
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M2T5I8
Sequence length 269
Comment (tr|M2T5I8|M2T5I8_COCSN) Uncharacterized protein {ECO:0000313|EMBL:EMD64501.1} KW=Complete proteome; Reference proteome OX=665912 OS=and spot blotch fungus) (Bipolaris sorokiniana). GN=COCSADRAFT_37081 OC=Pleosporaceae; Bipolaris.
Sequence
MSRTAALSSFIDSAPPGELADVTKAIKSILGNDSVQNELSPAFQKYNEEQFATTKLPGGS
TEVLVSQYNSLGDGRYYDIDTQSSFDFDHVTGKASAVQSYVVETSNDDLLKSLNKALSTH
AAEHYPKSSHGVYPIPSSSNFAIITVANKYSPTNYWNGRWRSSYTYDSSSGSITGSIKVD
VHYYEDGNVRLLTTKEVSVNGSGASGPEVVRKIAAEEKKYQEDLNKAFASLSEGAFKSLR
RQLPITRQKIEWEKISGYRLGQDIGGGRR
Download sequence
Identical sequences M2T5I8
XP_007699863.1.66866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]