SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M3HLQ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3HLQ2
Domain Number 1 Region: 147-422
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.44e-68
Family Capz beta-1 subunit 0.000000496
Further Details:      
 
Domain Number 2 Region: 1-106
Classification Level Classification E-value
Superfamily PRTase-like 8.39e-31
Family Phosphoribosylpyrophosphate synthetase-like 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3HLQ2
Sequence length 433
Comment (tr|M3HLQ2|M3HLQ2_CANMX) F-actin capping protein beta subunit isoforms 1 and 2 {ECO:0000313|EMBL:EMG48367.1} KW=Complete proteome; Reference proteome OX=1245528 OS=Candida maltosa (strain Xu316) (Yeast). GN=G210_1078 OC=Candida/Lodderomyces clade; Candida.
Sequence
MVLVGDVQDKICLLIDDMADTCGTLCKAADVLLTNGGAQKVVCMVTHGIFSGNAIERLNN
SNLEKVVCTNSLPIQDKLDQCSKIEMLDISSTLAEAIRRLHNGESLCEVIIFSTTDARKI
RSTKTNTNKIFKTLNNTPINEPQNIMDKFDSSLDLIRRLDPRSITSNLSNICALVSDEDL
VADLLSSVDTPLTITNCSKSGKDYLCCDYNRDGDSYRSPWSNVYYPELSSSDINEAPYPS
DFLRHLELKANDSFDIYRDLYYEGGISSVYLWDTAEDEDEGNGENALEDGFAGVVLFKKE
TDDKSGNWDSIHVFEVIKQSKNKYLYKLTTSVILNLENNKQGNLGLAGNLTRQLEQQQVI
DLDNGINLETNHLINLGQLVEKSEYNIRNLLQAVYFDKLKDILLKDLRSVGDANDKKLDS
LKQTEIIKGLQGL
Download sequence
Identical sequences M3HLQ2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]