SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M3III8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  M3III8
Domain Number - Region: 22-109
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0889
Family Capz alpha-1 subunit 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3III8
Sequence length 188
Comment (tr|M3III8|M3III8_CANMX) Regulator of rDNA transcription 14 {ECO:0000256|RuleBase:RU362137} KW=Complete proteome; Reference proteome OX=1245528 OS=Candida maltosa (strain Xu316) (Yeast). GN=G210_3606 OC=Candida/Lodderomyces clade; Candida.
Sequence
MSFHSNASKHQAETTISKLFSNILHTEPSSKKNSNKKPISSTQLVSNQFNHHTIKKKKTS
NKNINKKVEKEKSFNKFVKYNYIKNKAVKSESDQKYLKKLAKKNINKLNSVSKIDDFEIS
EEFDQVSSELLDSLKPKGGKRLRKKLLRVRPEDEADNGFEEKIKKGVISYPGLTPGLAPV
DYDEEDSE
Download sequence
Identical sequences M3III8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]