SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3J9M7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  M3J9M7
Domain Number - Region: 81-120
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.0366
Family VPS23 C-terminal domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3J9M7
Sequence length 158
Comment (tr|M3J9M7|M3J9M7_CANMX) Uncharacterized protein {ECO:0000313|EMBL:EMG48828.1} KW=Complete proteome; Reference proteome OX=1245528 OS=Candida maltosa (strain Xu316) (Yeast). GN=G210_0534 OC=Candida/Lodderomyces clade; Candida.
Sequence
MKLVEGLLLKDQLKKEASQLRELISKCCQAQSGDKPPFEVNELFAEYEELKMAEMKVSRE
IQITNNIIKFKYWDIDEERTMTQALADLSSISDNLYFVDKMIKGGIITYSWSSKEIRDIS
YVDVVKYQNKLKELRSKEYELKRRIQFANYEFDLIESK
Download sequence
Identical sequences M3J9M7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]