SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M3JA42 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3JA42
Domain Number 1 Region: 4-255
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.35e-64
Family Capz alpha-1 subunit 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3JA42
Sequence length 262
Comment (tr|M3JA42|M3JA42_CANMX) Uncharacterized protein {ECO:0000313|EMBL:EMG48978.1} KW=Complete proteome; Reference proteome OX=1245528 OS=Candida maltosa (strain Xu316) (Yeast). GN=G210_0358 OC=Candida/Lodderomyces clade; Candida.
Sequence
MSLKLTEIVDSLIESAPPVELKEVSQSLSALTTTSIDDNIEKFAQDKTIAIDNNNTIVSK
YNKDSQSSKYIDYVHKKLFNVDWKHGKVIDIEPYHNGTTDYPAVYDELVDKLAKYGDDYY
PSTFAYTVIPESEGLRIIIIGQRANHENFYTGQWKSNYVVSERGITGDVSLDIHYFEDGN
VRLKFNESINDEGDFVGSASKIVNFINDQENQIVIKIVDQFNNLNQQSFKNLRRLLPVTR
SKINWGSAIGNYRLGSDVVYKK
Download sequence
Identical sequences M3JA42

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]