SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3MYP1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  M3MYP1
Domain Number - Region: 4-94
Classification Level Classification E-value
Superfamily Clostridium neurotoxins, "coiled-coil" domain 0.0101
Family Clostridium neurotoxins, "coiled-coil" domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3MYP1
Sequence length 114
Comment (tr|M3MYP1|M3MYP1_HELPX) Uncharacterized protein {ECO:0000313|EMBL:EMH05563.1} KW=Complete proteome OX=1159036 OS=Helicobacter pylori GAM245Ai. GN=HMPREF1408_00867 OC=Helicobacteraceae; Helicobacter.
Sequence
KSEIQKLENQMIETATRLLTSYQVFLNNARDNANNQITENKTQSLEAITQAKESATTQIS
TNKTQAIANINEAKENATTQISNNQTQAINHITQEKTKATSEITEAKKRSLSKH
Download sequence
Identical sequences M3MYP1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]