SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M3U0S3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3U0S3
Domain Number 1 Region: 5-272
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 7.98e-84
Family Capz beta-1 subunit 0.000000351
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3U0S3
Sequence length 276
Comment (tr|M3U0S3|M3U0S3_ENTHI) F-actin capping protein beta subunit, putative {ECO:0000313|EMBL:EMH75645.1} KW=Complete proteome OX=885319 OS=Entamoeba histolytica HM-1:IMSS-B. GN=EHI8A_240780 OC=Eukaryota; Amoebozoa; Archamoebae; Entamoebidae; Entamoeba.
Sequence
MSQTDPLDYALDLMRRLPPQKVEDNLQMLIDLCPDLTDDLLSATDQPLKIVEDTTAKKSF
LICDYCRDGDSYRSPFSNKYFPAFPEGGLPSDELRQLEISLNDAFDMYREMYYEGGVHSV
YCWDINDGFAVCVLMKKTADQSKKGNPMKGTWDSINVIEVIPKGTSKAEYRLTSTVILYM
ETDCEATGKVAFAGSLTRQNEKVLSTTQKDSHIINIGTFVEETESRMRQILDAIYFSKSK
EITNNCRCQIGVSEQNKRTLMTKQINTQLRGRHDDD
Download sequence
Identical sequences M3U0S3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]