SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M3W7D2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3W7D2
Domain Number 1 Region: 6-274
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 6.28e-81
Family Capz alpha-1 subunit 0.00000238
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3W7D2
Sequence length 299
Comment (tr|M3W7D2|M3W7D2_FELCA) Capping actin protein of muscle Z-line alpha subunit 3 {ECO:0000313|Ensembl:ENSFCAP00000006711} KW=Complete proteome; Reference proteome OX=9685 OS=Felis catus (Cat) (Felis silvestris catus). GN=CAPZA3 OC=Felinae; Felis.
Sequence
MSLSVLSRKEKERVIRRLLIQAPPGEFVNAFDDLCLLIRDEKLMHHQGECAGHQHCQKYC
VPLSIDGNPVLLSHHNVMGDYRFFDYQSKLSFKFDLLQNQLKDIQSHGIIRNETEYLRNV
VLCALKLYVSDHYPKGNCNVLRKTVKNKEFLIACIEDHSYETRDCWNGLWKSKWIFQINP
FLTQVTGRIFVQAHFFKAVNLHIEISKDLKESLEIVNQAQLALSFARLVEEQENIFQVAV
LEELQELSNEALRKILRRDLPVTRTLIDWQRILSDLNLVMYPKLGYVIYSRSVLCNWII
Download sequence
Identical sequences M3W7D2
XP_014930148.1.86478 XP_019690177.1.62641 ENSFCAP00000006711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]