SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M3XJI6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XJI6
Domain Number 1 Region: 2-269
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.07e-96
Family Capz beta-1 subunit 0.000000000509
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3XJI6
Sequence length 273
Comment (tr|M3XJI6|M3XJI6_LATCH) Capping actin protein of muscle Z-line beta subunit {ECO:0000313|Ensembl:ENSLACP00000022892} KW=Complete proteome; Reference proteome OX=7897 OS=Latimeria chalumnae (West Indian ocean coelacanth). GN=CAPZB OC=Coelacanthiformes; Coelacanthidae; Latimeria.
Sequence
MSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYL
LCDYNRDGDSYRSPWSNKYDPPLDDGAMPSARLRKLEVEANDAFDQYRDLYFEGGVSSVY
LWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTN
KSGSGTMNLGGSLTRQMEKDETVSDSSPHIAIIGRLVEDMENKIRSTLNEIYFGKTKDIV
NGLRTVQSLADKSRQEALRGNLMDALKRKQEKV
Download sequence
Identical sequences M3XJI6
ENSLACP00000022892 XP_006004336.1.90931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]