SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M3XYB7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XYB7
Domain Number 1 Region: 8-270
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 7.59e-72
Family Capz alpha-1 subunit 0.000000011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3XYB7
Sequence length 275
Comment (tr|M3XYB7|M3XYB7_MUSPF) Uncharacterized protein {ECO:0000313|Ensembl:ENSMPUP00000004068} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN= OC=Mustelinae; Mustela.
Sequence
MADLEEQLSNEEKVYRAAKFIIHAPPGKFNEVFNDVWLPFNNDNLLREGAAHAFAQYNLD
QFIPKIEGYKDQILITKHGNLGNGKFLDSQNRISFKFDHLRKEATDPRPYERENVLKHGE
LLLYTKEHYPNGVCTDIWPKKKKKQSIVACRESYQFQRKNFWSHHWRSKWKFPITFLTTQ
AQVVGILKIQVHYYEDSNVQLVSHKDIQDFLTASTEAQTAKEFIKIIEAAENEYENYQMM
SDTTFKALLTVANYMTKIDWNKILSYRIGKEMQNA
Download sequence
Identical sequences M3XYB7
ENSMPUP00000004068 ENSMPUP00000004068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]