SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M3Y0T7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Y0T7
Domain Number 1 Region: 8-281
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.44e-117
Family Capz alpha-1 subunit 0.00000000023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3Y0T7
Sequence length 286
Comment (tr|M3Y0T7|M3Y0T7_MUSPF) Capping actin protein of muscle Z-line alpha subunit 1 {ECO:0000313|Ensembl:ENSMPUP00000004938} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=CAPZA1 OC=Mustelinae; Mustela.
Sequence
MADFEDRVSDEEKVRIAAKFITHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNMD
QFTPVKIEGYEDQVLITEHGDLGNSRFLDPRNKISFKFDHLRKEASDPQPEDVDGGLKSW
RESCDSALRAYVKDHYSNGFCTVYAKTIDGQQTIIACIESHQFQPKNFWNGRWRSEWKFT
ITPPTAQVVGVLKIQVHYYEDGNVQLVSHKDVQDSVTVSNEVQTAKEFIKIIEHAENEYQ
TAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA
Download sequence
Identical sequences L5K3L2 M3Y0T7
ENSPVAP00000002339 XP_003990521.1.62641 XP_004401376.1.74151 XP_004769839.1.14098 XP_006919709.1.64745 XP_007076432.1.5354 XP_011365470.1.92234 XP_019313413.1.44245 XP_019325056.1.44245 ENSMPUP00000004938 ENSPVAP00000002339 ENSMPUP00000004938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]