SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M3Y737 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Y737
Domain Number 1 Region: 40-516
Classification Level Classification E-value
Superfamily Sema domain 1.7e-158
Family Sema domain 0.000000000000077
Further Details:      
 
Domain Number 2 Region: 1264-1535
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 9.81e-112
Family Capz alpha-1 subunit 0.000000000553
Further Details:      
 
Domain Number 3 Region: 1080-1267
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.28e-53
Family Protein kinases, catalytic subunit 0.0000000094
Further Details:      
 
Domain Number 4 Region: 655-730
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000883
Family E-set domains of sugar-utilizing enzymes 0.032
Further Details:      
 
Domain Number 5 Region: 561-658
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000255
Family Other IPT/TIG domains 0.084
Further Details:      
 
Domain Number 6 Region: 518-564
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000419
Family Plexin repeat 0.0000656
Further Details:      
 
Domain Number 7 Region: 741-826
Classification Level Classification E-value
Superfamily E set domains 0.00000000237
Family Other IPT/TIG domains 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3Y737
Sequence length 1540
Comment (tr|M3Y737|M3Y737_MUSPF) Hepatocyte growth factor receptor {ECO:0000313|Ensembl:ENSMPUP00000007141} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=MET OC=Mustelinae; Mustela.
Sequence
MRAPAVLAPGILVLLFTLVQRSCGECKEALVKSEMNVNMKYQLPNFTAETPIQNVVLHKH
HIYLGAVNYIYVLNDKDLQKVAEYKTGPVLEHPDCSPCQDCSHKANLSGAVWKDNINMAL
LIDIYYDDQLISCGSVQRGTCQRHVLPRSNTADIQSEVHCMYSPQADEEPGQCPDCVVSA
LGTKVLISEKTRFINFFVGNTINSSSHPDHSLHSISVRRLKETQDGFKFLTDQSYIDVLP
EFRDSYPIKYVHAFESNHFIYFLTVQRETLDAQTFHTRVIRFCSVDSGLHSYMEMPLECI
LTEKRRKRSTREEVFNILQAAYVGKPGAHLAKQIGANLNDDILYGVFARSQPDSAEPMNR
SAVCAFPIKYVNEFFNKIVNKNNVRCLQHFYGPNHEHCFNRTLLRNSSGCEVRSDEYRTE
FTTALQRVDLFMGQFNQVLLTSISTFIKGDLTIANLGTSEGRFMQVVVSRSGSSTPHVNF
RLDSHPVSPEAIVEHPLNQNGYTLVVTGKKITKIPLNGLGCEHFQSCSQCLSAPPFVQCG
WCHDKCVQLEECPTGTWTQEICLPTIYEVFPTSAPLEGGTMLTICGWDFGFRRNNKFDLK
KTKVLLGNESCTLTLSESTTNMLKCTVGPAVNEHFNISIIIANGRGTAQYSKFSYVDPII
TSISPSYGPKTGGTLLTLNGKYLNSGNSRHISIGGETCTLKSVSDSILECYTPAQTTPTE
FPIKLKIDLANREMNSFSYQEDPIVYAIHPTKSFISGGSTITAIGKNLHSVSVLRMGINV
HEARRNFTVACQHRSNSEIICCTTPSLQQLSLQLPLKTKAFFMLDGIHSKYFDLIYVHNP
VFKPFEKPVMISIGNENVLEIKGNDIDPEAVKGEVLKVGNKSCETIYSDSEAVLCKVPND
LLKLNNELNIEWKQAVSSTILGKVIVQPDQNFTGLIVGVISISLIVLLLLGLFLWLKRRK
QIKDLGSELVRYDARVHTPHLDRLVSARSVSPTTEMVSNESVDYRATFPEDQFPNSSQNG
SCRQVQYPLTDLSPMLTSGDSDISSPLLQNTVHIDLSALNPELVQAVQHVVIGPSSLIVH
FNEVIGRGHFGCVYHGTLLDNDDKKIHCAVKSLNRITDIGEVSQFLTEGIIMKDFSHPNV
LSLLGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKYLASKK
FVHRDLAARNCMLDEKFTVKVADFGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQK
FTTKSDVVRIAAKFIIHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNLDQFTPVK
IEGYEDQVLITEHGDLGNGKFLDPKNRICFKFDHLRKEATDPRPYEAENAVESWRTSVET
ALRAYVKEHYPNGVCTVYGKKIDGQQTIIACIESHQFQAKNFWNGRWRSEWKFTITPSTT
QVVGILKIQVHYYEDGNVQLVSHKDIQDSLTVSNEVQTAKEFIKIVEAAENEYQTAISEN
YQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA
Download sequence
Identical sequences M3Y737
ENSMPUP00000007141 ENSMPUP00000007141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]