SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M4DHY9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M4DHY9
Domain Number 1 Region: 2-245
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.49e-71
Family Capz beta-1 subunit 0.000000397
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M4DHY9
Sequence length 256
Comment (tr|M4DHY9|M4DHY9_BRARP) Uncharacterized protein {ECO:0000313|EnsemblPlants:Bra016116.1-P} KW=Complete proteome; Reference proteome OX=51351 OS=pekinensis). GN= OC=Brassica.
Sequence
MEAALGLLRRMPPKQSETALSALLSLLPQHSSDLLSQVDLPLQVLRDAESRKDFILCEYN
RDADSYRSPWSNKYHPPLEDALYPSSELRKLEVEANDIFAIYRDQYYEGGISSVYMWEDD
NEGFVACFLIKKDGSKSGHGRRGCLEEGAWDAIHVIQVGPEEEEMAQYCLTSTIMLSLTT
DDEPSGKFGLSGSIRRQMKMELAVAEGHLCNMGRMIEELEGKLRNSLDQVYFGKTREMVC
TLRPPAEIVQMRLPDS
Download sequence
Identical sequences M4DHY9
Bra016116 XP_009105837.1.100322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]