SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M4VT39 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M4VT39
Domain Number 1 Region: 112-219
Classification Level Classification E-value
Superfamily PilZ domain-like 0.0000196
Family PilZ domain 0.012
Further Details:      
 
Weak hits

Sequence:  M4VT39
Domain Number - Region: 49-130
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0811
Family Capz beta-1 subunit 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M4VT39
Sequence length 230
Comment (tr|M4VT39|M4VT39_9PROT) Uncharacterized protein {ECO:0000313|EMBL:AGH96374.1} KW=Complete proteome; Reference proteome OX=1184267 OS=Bdellovibrio exovorus JSS. GN=A11Q_2158 OC=Bdellovibrionaceae; Bdellovibrio.
Sequence
MSSNASGGISEFLNELGESESLAALREAHSQQSPFVFKIDEFPTPQKVSIANFLDKRAIL
DAETSKIQLPENREISFKFNIGTEVYFVKTALKSHLNRYYFDMSSKVIQLKRRKEPRFMI
PKKWNQTASIVNLQIKGTSFKCLVHDISLSGIRFEMLEGVCSYKRDDIIHIKFQIYKRGE
VSTSAIVRFVLVRPNANPLLGIEFAQISDVNSQRVADIIEDIRIYHATTK
Download sequence
Identical sequences M4VT39
WP_015470864.1.98289 gi|471263126|ref|YP_007645981.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]