SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M5GG32 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M5GG32
Domain Number 1 Region: 1-245
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.01e-74
Family Capz beta-1 subunit 0.000000131
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M5GG32
Sequence length 255
Comment (tr|M5GG32|M5GG32_DACPD) F-actin capping protein beta subunit {ECO:0000313|EMBL:EJU04783.1} KW=Complete proteome; Reference proteome OX=1858805 OS=Dacryopinax primogenitus (strain DJM 731) (Brown rot fungus). GN=DACRYDRAFT_36829 OC=Dacrymycetes; Dacrymycetales; Dacrymycetaceae; Dacryopinax.
Sequence
IDALLDLMRRLPPQHVQQNLDKLVQLAAEDAEELVSSVDVPLRIATCKQTGKTYLCCDYN
KDGDSHRSPHSNEYDPPLPDGTFPSVKLRKLEVSANEAFDTYREMYFEGGISSVYLWDTD
PGAFAGVVLFKKRVFPSPDSWDSIHVFEALEKGRMANYKLTSTVMLTISAPGSEEGVVSL
SGSMTRQQEQDLPITSIQTHIANTGRMIEDMELKMRNQLQDVYFGKTRDVVGELRSAVGD
EEERRRRDLAKELQG
Download sequence
Identical sequences M5GG32

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]