SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M5J4Q9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  M5J4Q9
Domain Number - Region: 214-298
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.034
Family Capz alpha-1 subunit 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M5J4Q9
Sequence length 329
Comment (tr|M5J4Q9|M5J4Q9_9LACO) Uncharacterized protein {ECO:0000313|EMBL:EKW99413.1} KW=Complete proteome; Reference proteome OX=1227363 OS=Lactobacillus saerimneri 30a. GN=D271_02499 OC=Lactobacillus.
Sequence
MENIAERLVAKSIEAFIMGLEIYNKPTIKYRVEGFSFFICNAWELMLKAYLINKDGESSV
YFKDKPDRTLSLENVLKKVFTNKHDPIRLNIERIIVLRNTSTHFITEDYEMIYAPLFQAA
VINFNEKLIEFHNIDITDSISSNFLTLNMKIEDLSDNNIRAKYSNILAERLIRSRDEISK
DIANEGSGFAIPVETHFTLTKNKEDADITFRYAKESDNSMTILHDIKDPSAIYIYTTKKV
IQLVNKRLKKDNILLSKMKKGEKIKSVFTTNDFQLFIKFYGIKENSKYSYLYTIGNRYGY
SIKVIDFIVEEIKKRPDTIIETLKSELKK
Download sequence
Identical sequences M5J4Q9
WP_009552374.1.48960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]