SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M5WDE2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  M5WDE2
Domain Number - Region: 629-668
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0863
Family Capz alpha-1 subunit 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M5WDE2
Sequence length 718
Comment (tr|M5WDE2|M5WDE2_PRUPE) Uncharacterized protein {ECO:0000313|EMBL:EMJ11782.1} OX=3760 OS=Prunus persica (Peach) (Amygdalus persica). GN=PRUPE_ppa015080mg OC=Amygdaleae; Prunus.
Sequence
MADPIPAPHRTATDFFSDPLDSHPLWFKPALFLSPEFDSESYISDLRTFVPFDTLRSELQ
SYLASLNHELIDLINRDYADFVNLSTKLVDVDSAVVRMRAPLVELREKIEQFRGSVQNSL
VALTNGLKQRSEANEAREVLELLLDTFHVVSKVEKLIQELPSVPADWLNGDVNLAEKNFI
TNGTSLQHVENGTNLRDTQSMLLERIASEMNRLKFYIAHAQNLPFIENMEKRIQSASLLL
DASLGHCFVDGLEHRDANAIYNCLRAYAAIDNTRSAEELFRTTIVTPLIQNIIPHRTSLA
ATRPSGDDLENDYEQIKLCIDNNCKFLLEISFEENSGLHVFDFLANSILKEVLSAIKKGK
PGAFSPGRPTEFLKNYKSSLDFLAHLEGYCPSRSAVCKFRAEAVYIEFMKQWNFGVYFSL
RFQEIAGALDSVLVAASLVPVDNVHSDQGNSPDLTLKQSVTLLECLESCWREDVAVLSCA
DKFLRLSLQLLSRYSSWLSSGLAARKKGSTDSIPGREWAISAVPDDFIYIIHDIDFLYKR
VCGDFLEHVLKLLSSCPADVLDLVKPSILQGGNLLNDLVPLVINTIVEALVKKSNEGVEQ
LKGITATYRMTNKPRPVRHSPYVAAVVRPLKAFWEGERATKYLTSDTKHEVLLSAATEIT
GHYYETADNVISMARRTASSLQRIRQGAQRRGGASSDVSDQNVSDTDKISMQIFLDIQ
Download sequence
Identical sequences M5WDE2
ppa015080m|PACid:17656306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]