SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M5WDM9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M5WDM9
Domain Number 1 Region: 24-93
Classification Level Classification E-value
Superfamily TSP9-like 1.07e-21
Family TSP9-like 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M5WDM9
Sequence length 93
Comment (tr|M5WDM9|M5WDM9_PRUPE) Uncharacterized protein {ECO:0000313|EMBL:EMJ07388.1} KW=Complete proteome; Reference proteome OX=3760 OS=Prunus persica (Peach) (Amygdalus persica). GN=PRUPE_6G060300 OC=Amygdaleae; Prunus.
Sequence
MASLTMVFAPVPTGRASSRVYAATAAKGGSKEEKGLLDWILGGLAKEDQLLETDPILKKV
EDKNGATNGGRKGTVEIPQKKKGGFGGLFVKKD
Download sequence
Identical sequences M5WDM9
XP_007206189.1.23749 ppa013971m|PACid:17657001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]