SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M5WF00 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  M5WF00
Domain Number - Region: 13-78
Classification Level Classification E-value
Superfamily TSP9-like 0.0392
Family TSP9-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M5WF00
Sequence length 124
Comment (tr|M5WF00|M5WF00_PRUPE) Uncharacterized protein {ECO:0000313|EMBL:EMJ05340.1} KW=Complete proteome; Reference proteome OX=3760 OS=Prunus persica (Peach) (Amygdalus persica). GN=PRUPE_7G153900 OC=Amygdaleae; Prunus.
Sequence
MIHAIRSLRTQSPSNLVQKASGVRFRQNATISTDPDTKHNMDKTQNPNQQKTGDAMSHSF
GEGYATRSDEEGFGGVFSGNQSLPKTQQDQLIHENHPAYDKTQGSEVKEKEKGRHQTQAN
ASTN
Download sequence
Identical sequences M5WF00
XP_007204141.1.23749 ppa022555m|PACid:17658146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]