SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M5YR71 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  M5YR71
Domain Number - Region: 29-158
Classification Level Classification E-value
Superfamily Clostridium neurotoxins, "coiled-coil" domain 0.00144
Family Clostridium neurotoxins, "coiled-coil" domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M5YR71
Sequence length 182
Comment (tr|M5YR71|M5YR71_HELPX) Uncharacterized protein {ECO:0000313|EMBL:EMJ45432.1} KW=Complete proteome OX=1159064 OS=Helicobacter pylori GAMchJs136i. GN=HMPREF1436_00133 OC=Helicobacteraceae; Helicobacter.
Sequence
KLKMKEYERFFNDFNTSMHANEQEVTATLNANTENIKSEIQKLENQMIETTTRLLTSYQI
FLNQARDNANNQITENKTQSLEALNQAKNTANNEINTNQTQAITNINEAKTTANNEISAN
QTQAINNINEAKTNATTQINANKQEVLNNITQEKTKATSEITEAKKTIIIKTLIFLRLNK
AC
Download sequence
Identical sequences M5YR71
WP_001979083.1.51078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]